PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G038419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 197aa    MW: 21870.5 Da    PI: 10.3546
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G038419.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.93.9e-344312914100
                DUF260  14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                           + C +apyfpae p+kfanvhk+FGasnv kll+++ +++r+da++sl+yeA+ r+rdPvyG+vgvi+ lq+ql+ql+ +l+++k+e
  HL.SW.v1.0.G038419.1  43 SACLFAPYFPAEPPQKFANVHKVFGASNVAKLLNEVAPSQRKDAVNSLAYEADTRLRDPVYGCVGVITLLQHQLRQLQMDLSSTKSE 129
                           57********************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.4129130IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3343127IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAGFLAKLFV TTKREREVRT CRWRLRVRRA RGVRCCGGSA IRSACLFAPY FPAEPPQKFA  60
NVHKVFGASN VAKLLNEVAP SQRKDAVNSL AYEADTRLRD PVYGCVGVIT LLQHQLRQLQ  120
MDLSSTKSEL SKYQNLGLIA HHHHQMINYD ATTTLPVPDM NVSDQFIRST NLGPPPPGIM  180
TAAPLMIPRL YIALAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO044791e-45LBD6_ARATH; LOB domain-containing protein 6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-47LBD family protein